PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21044_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 246aa    MW: 27575.8 Da    PI: 9.9906
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21044_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF551e-171150342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    i n+s r+ tf kR++g++KK +ELS+LC++e++ iifs+
  Neem_21044_f_1 11 IPNDSARKATFKKRKKGLMKKVSELSTLCGIEACAIIFSP 50
                    889************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.829149IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-25295IPR002100Transcription factor, MADS-box
CDDcd002662.95E-23285No hitNo description
PRINTSPR004042.4E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MTRKKVKLAY IPNDSARKAT FKKRKKGLMK KVSELSTLCG IEACAIIFSP YDAQPEIWPS  60
PVGVQRVLSQ FKKMPEMEQS KKMVNQDSFL RQRIAKANEQ LKRQKKDNRE KEITQVMFQG  120
LTAGKVLQGL NMLDLNDLGW IVDQNLKEIS KRIVMLSKVG SISSATTVQY SSSQGETTAP  180
VSASQGEKCS GFEQMGMEAM HKQQWFVDLM NSQENNMGGF GGEEVMFPFG DGGSTHSSLW  240
ANPFYP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYIPNDSARKATFKKRK
22125KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428341.11e-120hypothetical protein CICLE_v10013728mg
RefseqXP_006480389.11e-120PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-69AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV4SWL01e-120V4SWL0_9R
STRINGVIT_14s0060g00300.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-70AGAMOUS-like 80